HPA026776

GCNT2 antibody from Atlas Antibodies
bA360O19.2, bA421M1.1, CCAT, GCNT5, IGNT, II, NACGT1, NAGCT1, ULG3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026776
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026776, RRID:AB_1849573
Product name
Anti-GCNT2
Provider product page
Atlas Antibodies - HPA026776
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNI
TPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNIL
KTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAID
LLQWSKDT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -