Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28690 - Provider product page
- Provider
- Abnova Corporation
- Product name
- EMILIN1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant EMILIN1.
- Antigen sequence
PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGD
DCAESPAPALGPASSTPRPLARPARPNLSGSSAGS
PLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRG
VLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPG
VHETLNE- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot anyalysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human cell line A-431, Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with EMILIN1 polyclonal antibody (Cat # PAB28690).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow with EMILIN1 polyclonal antibody (Cat # PAB28690) shows moderate cytoplasmic positivity in megakaryocytes at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry