HPA002822

EMILIN1 antibody from Sigma-Aldrich
DKFZp586M121, gp115
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002822
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002822, RRID:AB_1078738
Product name
Anti-EMILIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002822
Antibody type
Polyclonal
Antigen
EMILIN-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGD
DCAESPAPALGPASSTPRPLARPARPNLSGSSAGS
PLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRG
VLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPG
VHETLNE
Storage
-20C
Provider Type Product Number
- No reagents -