HPA019917

CER1 antibody from Sigma-Aldrich
DAND4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019917
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019917, RRID:AB_1846539
Product name
Anti-CER1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019917
Antibody type
Polyclonal
Antigen
Cerberus Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFW
HHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQ
TITHEGCEKVVVQNNL
Storage
-20C
Provider Type Product Number
- No reagents -