HPA003596

AGTR1 antibody from Atlas Antibodies
AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT2R1, AT2R1A, AT2R1B, HAT1R
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003596
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003596, RRID:AB_1233425
Product name
Anti-AGTR1
Provider product page
Atlas Antibodies - HPA003596
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSS
TKKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -