Antibody data

Product number
ABIN405668
Provider
antibodies-online
Product name
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405668
Antibody type
Polyclonal
Antigen
The immunogen for anti-TPST2 antibody: synthetic peptide directed towards the middle region of human TPST2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian
Host
Rabbit
Antigen sequence
KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLK
LILDF LGIAWSDAVL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -