HPA021054

TPST2 antibody from Sigma-Aldrich
TANGO13B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021054
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021054, RRID:AB_1858221
Product name
Anti-TPST2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021054
Antibody type
Polyclonal
Antigen
Protein-tyrosine sulfotransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFL
LMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKW
NKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSL
KLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIER
STDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPM
LAQLGY
Storage
-20C
Provider Type Product Number
- No reagents -