HPA002823

TM4SF1 antibody from Atlas Antibodies
L6, M3S1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002823
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002823, RRID:AB_1079221
Product name
Anti-TM4SF1
Provider product page
Atlas Antibodies - HPA002823
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEP
KHIVEWNVSLFSI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -