HPA002823

TM4SF1 antibody from Sigma-Aldrich
L6, M3S1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002823, RRID:AB_1079221
Product name
Anti-TM4SF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002823
Antibody type
Polyclonal
Antigen
Transmembrane 4 L6 family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEP
KHIVEWNVSLFSI
Storage
-20C
Provider Type Product Number
- No reagents -