Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005810-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005810-M01, RRID:AB_913844
- Product name
- RAD1 monoclonal antibody (M01), clone 1G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAD1.
- Antigen sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIH
FREHATCFATKNGIKVTVENAKCVQANAFIQAGIF
QEFKVQEESVTFRINLTVLL- Isotype
- IgG
- Antibody clone number
- 1G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M01), clone 1G2.Lane 1: RAD1 transfected lysate(32.43 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAD1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol