HPA026866

ABHD12 antibody from Atlas Antibodies
ABHD12A, BEM46L2, C20orf22, dJ965G21.2, DKFZP434P106
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026866
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026866, RRID:AB_1844446
Product name
Anti-ABHD12
Provider product page
Atlas Antibodies - HPA026866
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFL
DPITSSGIKFANDENVKHISCPLLILHAEDDPVVP
FQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
KYIYKSPELPRILRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -