HPA026866

ABHD12 antibody from Sigma-Aldrich
ABHD12A, BEM46L2, C20orf22, dJ965G21.2, DKFZP434P106
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026866, RRID:AB_1844446
Product name
Anti-ABHD12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026866
Antibody type
Polyclonal
Antigen
Abhydrolase domain-containing protein 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFL
DPITSSGIKFANDENVKHISCPLLILHAEDDPVVP
FQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
KYIYKSPELPRILRP
Storage
-20C
Provider Type Product Number
- No reagents -