H00006619-B01

SNAPC3 antibody from Abnova Corporation
MGC132011, MGC33124, PTFbeta, SNAP50

Antibody data

Product number
H00006619-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006619-B01, RRID:AB_1580841
Product name
SNAPC3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006619-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SNAPC3 protein.
Antigen sequence
MAEGSRGGPTCSGVGGRQDPVSGSGGCNFPEYELP
ELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASA
LPGSQAADSDREDAAVARDLDCSLEAAAELRAVCG
LDKLKCLEDGEDPEVIPENTDLVTLGVRKRFLEHR
EETITIDRACRQETFVYEMESHAIGKKPENSADMI
EEGELILSVNILYPVIFHKHKEHKPYQTMLVLGSQ
KLTQLRDSIRCVSDLQIGGEFSNTPDQAPEHISKD
LYKSAFFF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -