Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182945 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Small Nuclear RNA Activating Complex, Polypeptide 3, 50kDa (SNAPC3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAPC3 antibody: synthetic peptide directed towards the N terminal of human SNAPC3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
CSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVG
AFGEL WRGRLRGAGD- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The retinoblastoma tumor suppressor protein targets distinct general transcription factors to regulate RNA polymerase III gene expression.
Hirsch HA, Gu L, Henry RW
Molecular and cellular biology 2000 Dec;20(24):9182-91
Molecular and cellular biology 2000 Dec;20(24):9182-91
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting