Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501242 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Small Nuclear RNA Activating Complex, Polypeptide 3, 50kDa (SNAPC3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAPC3 antibody: synthetic peptide directed towards the middle region of human SNAPC3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKS
AFFYF EGTFYNDKRY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The unorthodox SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC.
Jawdekar GW, Hanzlowsky A, Hovde SL, Jelencic B, Feig M, Geiger JH, Henry RW
The Journal of biological chemistry 2006 Oct 13;281(41):31050-60
The Journal of biological chemistry 2006 Oct 13;281(41):31050-60
No comments: Submit comment
No validations: Submit validation data