ABIN631990

antibody from antibodies-online

Targeting: BRIX1 BRIX, BXDC2, FLJ11100

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631990 - Provider product page
Provider: antibodies-online
Product name: anti-BRX1, Biogenesis of Ribosomes, Homolog (S. Cerevisiae) (BRIX1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

BRIX1 protein structure - ABIN631990 shown in red.