HPA003160

RAB3A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003160, RRID:AB_1079731
Product name
Anti-RAB3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003160
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDI
TNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDM
EDERVVSSERGRQLADHLGFEFFEASAKDNINVKQ
TFERLVDVICEKMSESLDTADPAVTGAKQGPQLSD
QQV
Storage
-20C
Provider Type Product Number
- No reagents -