Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028921 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-BHLHE40
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQT
CAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELL
QGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKN
CVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Mutual suppression between BHLHE40/BHLHE41 and the MIR301B-MIR130B cluster is involved in epithelial-to-mesenchymal transition of endometrial cancer cells.
Regulation of the Mechanism of TWIST1 Transcription by BHLHE40 and BHLHE41 in Cancer Cells.
Novel signatures of cancer‐associated fibroblasts
Asanoma K, Hori E, Yoshida S, Yagi H, Onoyama I, Kodama K, Yasunaga M, Ohgami T, Kaneki E, Okugawa K, Yahata H, Kato K
Oncotarget 2019 Jul 23;10(45):4640-4654
Oncotarget 2019 Jul 23;10(45):4640-4654
Regulation of the Mechanism of TWIST1 Transcription by BHLHE40 and BHLHE41 in Cancer Cells.
Asanoma K, Liu G, Yamane T, Miyanari Y, Takao T, Yagi H, Ohgami T, Ichinoe A, Sonoda K, Wake N, Kato K
Molecular and cellular biology 2015 Dec;35(24):4096-109
Molecular and cellular biology 2015 Dec;35(24):4096-109
Novel signatures of cancer‐associated fibroblasts
Bozóky B, Savchenko A, Csermely P, Korcsmáros T, Dúl Z, Pontén F, Székely L, Klein G
International Journal of Cancer 2013;133(2):286-293
International Journal of Cancer 2013;133(2):286-293
No comments: Submit comment
No validations: Submit validation data