HPA028922

BHLHE40 antibody from Atlas Antibodies
BHLHB2, bHLHe40, Clast5, DEC1, SHARP2, STRA13
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028922
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028922, RRID:AB_2672828
Product name
Anti-BHLHE40
Provider product page
Atlas Antibodies - HPA028922
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAY
LPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDK
ISAPLLMPQRLPSPLPAHPSVDSSVLLQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -