H00008553-M01

BHLHE40 antibody from Abnova Corporation
BHLHB2, bHLHe40, Clast5, DEC1, SHARP2, STRA13

Antibody data

Product number
H00008553-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008553-M01, RRID:AB_489928
Product name
BHLHB2 monoclonal antibody (M01), clone 5B1
Provider product page
Abnova Corporation - H00008553-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BHLHB2.
Antigen sequence
LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTR
DLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVM
DFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
Isotype
IgG
Antibody clone number
5B1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -