H00008553-M01
antibody from Abnova Corporation
Targeting: BHLHE40
BHLHB2, Clast5, DEC1, SHARP2, STRA13
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008553-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008553-M01, RRID:AB_489928
- Product name
- BHLHB2 monoclonal antibody (M01), clone 5B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BHLHB2.
- Antigen sequence
LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTR
DLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVM
DFKEKPSSPAKGSEGPGKNCVPVIQRTFAH- Isotype
- IgG
- Antibody clone number
- 5B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-18a inhibits hypoxia-inducible factor 1α activity and lung metastasis in basal breast cancers.
A new role for sterol regulatory element binding protein 1 transcription factors in the regulation of muscle mass and muscle cell differentiation.
Krutilina R, Sun W, Sethuraman A, Brown M, Seagroves TN, Pfeffer LM, Ignatova T, Fan M
Breast cancer research : BCR 2014 Jul 28;16(4):R78
Breast cancer research : BCR 2014 Jul 28;16(4):R78
A new role for sterol regulatory element binding protein 1 transcription factors in the regulation of muscle mass and muscle cell differentiation.
Lecomte V, Meugnier E, Euthine V, Durand C, Freyssenet D, Nemoz G, Rome S, Vidal H, Lefai E
Molecular and cellular biology 2010 Mar;30(5):1182-98
Molecular and cellular biology 2010 Mar;30(5):1182-98
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BHLHB2 monoclonal antibody (M01), clone 5B1. Western Blot analysis of BHLHB2 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BHLHB2 monoclonal antibody (M01), clone 5B1. Western Blot analysis of BHLHE40 expression in K-562.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BHLHB2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol