Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182914 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Basic Helix-Loop-Helix Family, Member E40 (BHLHE40) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESE
EPPTK KNRMQLSDDE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association, mutual stabilization, and transcriptional activity of the STRA13 and MSP58 proteins.
Ivanova AV, Ivanov SV, Lerman ML
Cellular and molecular life sciences : CMLS 2005 Feb;62(4):471-84
Cellular and molecular life sciences : CMLS 2005 Feb;62(4):471-84
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Rabbit Anti-BHLHE40 Antibody ,Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 μg/mL Magnification:.00X