HPA028921

BHLHE40 antibody from MilliporeSigma / Merck KGaA
BHLHB2, bHLHe40, Clast5, DEC1, SHARP2, STRA13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028921
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028921, RRID:AB_10611811
Product name
Anti-BHLHE40 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028921
Antibody type
Polyclonal
Antigen
basic helix-loop-helix family, member e40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQT
CAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELL
QGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKN
CVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKG
Storage
-20C
Provider Type Product Number
- No reagents -