Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031124 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031124, RRID:AB_10601044
- Product name
- Anti-PAK6
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NRHGMKAAKHGSEEARPQSCLVGSATGRPGGEGSP
SPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPP
PQSKPNSSFRPPQKDNPPSLVAKAQSLPSDQPVGT
FSPLTTSDTSSPQKSLRTAP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PAK6 Phosphorylates 14-3-3γ to Regulate Steady State Phosphorylation of LRRK2
Leucine‐rich repeat kinase 2 interacts with p21‐activated kinase 6 to control neurite complexity in mammalian brain
Civiero L, Cogo S, Kiekens A, Morganti C, Tessari I, Lobbestael E, Baekelandt V, Taymans J, Chartier-Harlin M, Franchin C, Arrigoni G, Lewis P, Piccoli G, Bubacco L, Cookson M, Pinton P, Greggio E
Frontiers in Molecular Neuroscience 2017;10
Frontiers in Molecular Neuroscience 2017;10
Leucine‐rich repeat kinase 2 interacts with p21‐activated kinase 6 to control neurite complexity in mammalian brain
Civiero L, Cirnaru M, Beilina A, Rodella U, Russo I, Belluzzi E, Lobbestael E, Reyniers L, Hondhamuni G, Lewis P, Van den Haute C, Baekelandt V, Bandopadhyay R, Bubacco L, Piccoli G, Cookson M, Taymans J, Greggio E
Journal of Neurochemistry 2015;135(6):1242-1256
Journal of Neurochemistry 2015;135(6):1242-1256
No comments: Submit comment
No validations: Submit validation data