HPA003154

NSF antibody from Sigma-Aldrich
SKD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003154
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003154, RRID:AB_1079508
Product name
Anti-NSF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003154
Antibody type
Polyclonal
Antigen
Vesicle-fusing ATPase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQ
EDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNS
DRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIK
ICSPDK
Storage
-20C
Provider Type Product Number
- No reagents -