Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32076 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- ADRA1A Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the ADRA1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.