HPA029678

ADRA1A antibody from MilliporeSigma / Merck KGaA
ADRA1C, ADRA1L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029678
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029678, RRID:AB_10602108
Product name
Anti-ADRA1A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029678
Antibody type
Polyclonal
Antigen
adrenergic, alpha-1A-, receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAFQNVLRIQCLRRKQSSKHALGYTLHPPSQAVEG
QHKDMVRIPVGSRETFYRISKTDGVCEWKF
Storage
-20C
Provider Type Product Number
- No reagents -