Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022862 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KCNIP4
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKE
RLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP
EALELLEAQSKFT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references The Stoichiometry and Biophysical Properties of the Kv4 Potassium Channel Complex with K+ Channel-interacting Protein (KChIP) Subunits Are Variable, Depending on the Relative Expression Level
Divergent roles of ALS-linked proteins FUS/TLS and TDP-43 intersect in processing long pre-mRNAs
Kitazawa M, Kubo Y, Nakajo K
Journal of Biological Chemistry 2014;289(25):17597-17609
Journal of Biological Chemistry 2014;289(25):17597-17609
Divergent roles of ALS-linked proteins FUS/TLS and TDP-43 intersect in processing long pre-mRNAs
Lagier-Tourenne C, Polymenidou M, Hutt K, Vu A, Baughn M, Huelga S, Clutario K, Ling S, Liang T, Mazur C, Wancewicz E, Kim A, Watt A, Freier S, Hicks G, Donohue J, Shiue L, Bennett C, Ravits J, Cleveland D, Yeo G
Nature Neuroscience 2012;15(11):1488-1497
Nature Neuroscience 2012;15(11):1488-1497
No comments: Submit comment
No validations: Submit validation data