Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501313 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kv Channel Interacting Protein 4 (KCNIP4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKER
LMKLL PCSAAKTSSP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
Uhl GR, Liu QR, Drgon T, Johnson C, Walther D, Rose JE, David SP, Niaura R, Lerman C
Archives of general psychiatry 2008 Jun;65(6):683-93
Archives of general psychiatry 2008 Jun;65(6):683-93
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting