Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183051 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kv Channel Interacting Protein 4 (KCNIP4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDEL
EMATV RHRPEALELL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4.
Morohashi Y, Hatano N, Ohya S, Takikawa R, Watabiki T, Takasugi N, Imaizumi Y, Tomita T, Iwatsubo T
The Journal of biological chemistry 2002 Apr 26;277(17):14965-75
The Journal of biological chemistry 2002 Apr 26;277(17):14965-75
No comments: Submit comment
No validations: Submit validation data