HPA022862

KCNIP4 antibody from Sigma-Aldrich
CALP, KCHIP4, MGC44947
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022862, RRID:AB_1852654
Product name
Anti-KCNIP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022862
Antibody type
Polyclonal
Antigen
Kv channel-interacting protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKE
RLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP
EALELLEAQSKFT
Storage
-20C
Provider Type Product Number
- No reagents -