HPA003725

ERICH1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003725, RRID:AB_1853023
Product name
Anti-ERICH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003725
Antibody type
Polyclonal
Antigen
Glutamate-rich protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DASEEDPTWAGEEEGADSGEEDGADASEEDDTITN
EKAHSILNFLKSTQEMYFYDGVSRDAASAALADAA
EELLDRLASHSMLPSDVSILYHMKTLLLLQDTERL
KHALEMFPEHCTMPPDHARVISAFFSYWITH
Storage
-20C
Provider Type Product Number
- No reagents -