HPA023295

NPLOC4 antibody from Sigma-Aldrich
FLJ20657, KIAA1499, NPL4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023295
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023295, RRID:AB_1854587
Product name
Anti-NPLOC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023295
Antibody type
Polyclonal
Antigen
Nuclear protein localization protein 4 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKG
KFVALENISCKIKSGCEGHLPWPNGICTKCQPSAI
TLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQH
FGYL
Storage
-20C
Provider Type Product Number
- No reagents -