HPA003222

PTK7 antibody from Atlas Antibodies
CCK4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003222
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003222, RRID:AB_1079713
Product name
Anti-PTK7
Provider product page
Atlas Antibodies - HPA003222
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVY
WLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTF
QCVARDDVTGEEARSANASFNIKWIEAGPVVLKHP
ASEAEIQPQTQVTLRCHIDGHPRPTYQWFR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -