Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004739-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004739-M01, RRID:AB_489906
- Product name
- NEDD9 monoclonal antibody (M01), clone 1B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEDD9.
- Antigen sequence
PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVP
PSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPS
RYQKDVYDIPPSHTTQGVYDIPPSSAKGPV- Isotype
- IgG
- Antibody clone number
- 1B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Evidence that common variation in NEDD9 is associated with susceptibility to late-onset Alzheimer's and Parkinson's disease.
Li Y, Grupe A, Rowland C, Holmans P, Segurado R, Abraham R, Jones L, Catanese J, Ross D, Mayo K, Martinez M, Hollingworth P, Goate A, Cairns NJ, Racette BA, Perlmutter JS, O'Donovan MC, Morris JC, Brayne C, Rubinsztein DC, Lovestone S, Thal LJ, Owen MJ, Williams J
Human molecular genetics 2008 Mar 1;17(5):759-67
Human molecular genetics 2008 Mar 1;17(5):759-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NEDD9 expression in transfected 293T cell line by NEDD9 monoclonal antibody (M01), clone 1B4.Lane 1: NEDD9 transfected lysate(92.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NEDD9 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol