H00004739-M01A

NEDD9 antibody from Abnova Corporation
CAS-L, CASS2, HEF1

Antibody data

Product number
H00004739-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004739-M01A, RRID:AB_1575897
Product name
NEDD9 monoclonal antibody (M01A), clone 1B4
Provider product page
Abnova Corporation - H00004739-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NEDD9.
Antigen sequence
PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVP
PSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPS
RYQKDVYDIPPSHTTQGVYDIPPSSAKGPV
Isotype
IgG
Antibody clone number
1B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -