Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311408 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Neural Precursor Cell Expressed, Developmentally Down-Regulated 9 (NEDD9) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9
- Description
- Protein A purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEK
ANPQE RDGVYDVPLH- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Evidence that common variation in NEDD9 is associated with susceptibility to late-onset Alzheimer's and Parkinson's disease.
Li Y, Grupe A, Rowland C, Holmans P, Segurado R, Abraham R, Jones L, Catanese J, Ross D, Mayo K, Martinez M, Hollingworth P, Goate A, Cairns NJ, Racette BA, Perlmutter JS, O'Donovan MC, Morris JC, Brayne C, Rubinsztein DC, Lovestone S, Thal LJ, Owen MJ, Williams J
Human molecular genetics 2008 Mar 1;17(5):759-67
Human molecular genetics 2008 Mar 1;17(5):759-67
No comments: Submit comment
No validations: Submit validation data