HPA019647

TRIM35 antibody from Sigma-Aldrich
HLS5, KIAA1098, MAIR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019647, RRID:AB_1858291
Product name
Anti-TRIM35 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019647
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 35 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILD
AMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQ
MEMKEDDVSFLM
Storage
-20C
Provider Type Product Number
- No reagents -