HPA044303

ZNF337 antibody from Atlas Antibodies
dJ694B14.1

Antibody data

Product number
HPA044303
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044303, RRID:AB_2678890
Product name
Anti-ZNF337
Provider product page
Atlas Antibodies - HPA044303
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSHLVSLGIYAEHVLRPKNLGLAHQRQQQLQFSDQ
SFQSDTAEGQEKEKSTKPMAFSSPPLRHAVSSRRR
NSVVEIESSQGQRENPTEIDKVLKGIENSRWGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -