Antibody data

Product number
ABIN183565
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 337 (ZNF337) (Middle Region) antibody
Provider product page
antibodies-online - ABIN183565
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF337 antibody: synthetic peptide directed towards the middle region of human ZNF337
Description
Protein A purified
Reactivity
Human
Host
Rabbit
Antigen sequence
GEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVC
KECGR GYTNKSYFVV
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -