AV37761

ZNF337 antibody from Sigma-Aldrich
dJ694B14.1
No application information provided.

Antibody data

Product number
AV37761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV37761, RRID:AB_1859202
Product name
Anti-ZNF337 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV37761
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF337 with an internal ID of P08841
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
GEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVC
KECGRGYTNKSYFVV
Storage
-20C
Provider Type Product Number
- No reagents -