HPA001176

PRPF39 antibody from Atlas Antibodies
FLJ11128, FLJ20666
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001176
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001176, RRID:AB_2171026
Product name
Anti-PRPF39
Provider product page
Atlas Antibodies - HPA001176
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DINWENEQGNLREVTAIYDRILGIPTQLYSHHFQR
FKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGD
DGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEI
HQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKA
QL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -