HPA001176

PRPF39 antibody from Sigma-Aldrich
FLJ11128, FLJ20666
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001176
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001176, RRID:AB_2171026
Product name
Anti-PRPF39 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001176
Antibody type
Polyclonal
Antigen
Pre-mRNA-processing factor 39 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DINWENEQGNLREVTAIYDRILGIPTQLYSHHFQR
FKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGD
DGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEI
HQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKA
QL
Storage
-20C
Provider Type Product Number
- No reagents -