H00010133-B01

OPTN antibody from Abnova Corporation
FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP

Antibody data

Product number
H00010133-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010133-B01, RRID:AB_1204749
Product name
OPTN MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010133-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OPTN protein.
Antigen sequence
MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTF
TPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE
ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENE
KLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK
DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSE
DSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA
LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQ
KVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG
STEKENDEEKGPETVGSEVEALNLQVTSLFKELQE
AHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE
KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSK
LTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQE
EDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE
QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGART
SDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE
VLPDIDTLQIHVMDCII
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -