HPA003360

OPTN antibody from Atlas Antibodies
FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003360
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003360, RRID:AB_1079528
Product name
Anti-OPTN
Provider product page
Atlas Antibodies - HPA003360
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSV
KEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFE
HEELTVSQLLLCLREGNQKVERLEVALKEAKERVS
DFEKKTSNRSEIETQTEGSTEKENDEEKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -