HPA003279

OPTN antibody from Sigma-Aldrich
FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003279
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003279, RRID:AB_1079527
Product name
Anti-OPTN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003279
Antibody type
Polyclonal
Antigen
Optineurin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LELAEKALASKQLQMDEMKQTIAKQEEDLETMTIL
RAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVL
LKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYL
VQRGAEDRDWRQQRNIPIHSCPKCGEVL
Storage
-20C
Provider Type Product Number
- No reagents -