HPA024059

LMCD1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024059
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024059, RRID:AB_1852950
Product name
Anti-LMCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024059
Antibody type
Polyclonal
Antigen
LIM and cysteine-rich domains protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEAL
GVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTN
GSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGY
NKQWHPTCFVCAKCSEPLVDLIYFWKDGA
Storage
-20C
Provider Type Product Number
- No reagents -