HPA016435

TSPAN4 antibody from Sigma-Aldrich
NAG-2, TETRASPAN, TM4SF7, TSPAN-4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016435, RRID:AB_2304238
Product name
Anti-TSPAN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016435
Antibody type
Polyclonal
Antigen
Tetraspanin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSI
IQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSE
SCGLHAPGTWWKAPCYETVKVWLQENL
Storage
-20C
Provider Type Product Number
- No reagents -