Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007347-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007347-M01, RRID:AB_509097
- Product name
- UCHL3 monoclonal antibody (M01), clone 4E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UCHL3.
- Antigen sequence
PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEK
VDLHFIALVHVDGHLYELDGRKPFPINHGETSDET
LLEDAIEVCKKFMERDPDELRFNAIALSAA- Isotype
- IgG
- Antibody clone number
- 4E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
Nogueira da Costa A, Mijal RS, Keen JN, Findlay JB, Wild CP
Proteomics 2011 May;11(10):1903-14
Proteomics 2011 May;11(10):1903-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UCHL3 monoclonal antibody (M01), clone 4E9. Western Blot analysis of UCHL3 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UCHL3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol