HPA019678

UCHL3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019678, RRID:AB_1858583
Product name
Anti-UCHL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019678
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase isozyme L3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVY
GMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE
EKIKSQGQDVTSSVYFMKQTISN
Storage
-20C
Provider Type Product Number
- No reagents -