HPA024133

CCDC171 antibody from Atlas Antibodies
bA536D16.1, bA778P13.1, C9orf93, Em:AL513423.1, FLJ39267, FLJ46740
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024133
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024133, RRID:AB_1845848
Product name
Anti-CCDC171
Provider product page
Atlas Antibodies - HPA024133
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASTRIMTLEKEMTSHRSHIAALKSELHTACLRENA
SLQSIGSRDHSNLSIPSRAPLPADTTGIGDFLPLK
AELDTTYTFLKETFINTVPHALTSSHSSPVTMSAN
ANRPTQI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -